Dr. Bryan Ardis - Defends the SNAKE Venom Theory - DONT TAKE the JAB! - RSB Show
827 Views
13
Source "Rober Scott Bell Show" ---> https://www.youtube.com/watch?v=hP3_jTo8CuA&t=3s
This how you DO Science ... you QUESTION the SCIENCE. I hope these good Doctors will CONTINUE to discuss the cause of this SCAM-DEMIC (which may have been nothing more than relableling the Cold and Flu as COVID) and STOP the JAB!!!
Steve Kirsch comment - The video "WATCH the WATER" is out. I've seen it. A few parts I agree with. For most other parts I'm skeptical. Bryan met with us so we had an opportunity to ask questions. Some think it is worthless. Some don't.
Dr. Bryan Ardis, COVID origins, Watch The Water, Snake Venom, Hour 2 ENCORE - Paul Barattiero, Hydration, Synergy Science, Anti-oxidant water, ECHO water options and MORE! ---> http://www.robertscottbell.com/natural-remedies/dr-bryan-ardis-covid-origins-watch-the-water-snake-venom-hour-2-encore-paul-barattiero-hydration-synergy-science-anti-oxidant-water-echo-water-options-and-more/
Dr Adris is EXCITED to be on the Hopium Tour ... These guys are networking together in support of the truth about the DANGER of the JAB but they really AREN'T trying to take down the DEEP State Cabal or EXPOSE the EVIL of Zionist Federal Reserve ... They just want the WARP SPEED King Trump to RULE over the NWO.
Rober Bell says we can address the "Energetic Power" of the body so you can heal yourself (This sounds like New Age Crap-o-la). The body is under the power of God ... He orchestrates LIFE and brings HEALING and Jesus is the POWER who holds ALL things together.
He is before all things, and in Him all things hold together. - Cor 1:17
The SPIKE in the Pathogen and the SPIKE Genetic mRNA code in the JAB is a synthetic form of SNAKE Venom from the King Snake or Crete Snake.
Drew Weissman and Katalin Kariko Developed the current mRNA JAB with NIH funding since 2009 ---> https://www.bu.edu/articles/2021/how-drew-weissman-and-katalin-kariko-developed-mrna-technology-inside-covid-vaccines/
By altering one of mRNA’s four building blocks, known as nucleosides, Weissman and Karikó found that their modified mRNA could fly under the radar of the body’s immune system, no longer causing inflammation. It was a game changer, and they both knew it.
They used SNAKE Venom to do the mRNA Gene editing ... to make the... to tie together Genetic code.
Dr Ardis is aware that MANY of his colleagues are NOT in agreement with his claims that COVID is Snake Venom but some Genetically modified Respiratory Coronavirus but they are ON the same page to RID the world of VACCINES!!!
The Straight Unswiveled Truth on Snake Venom Claims with Andrew Kaufman, M.D. ---> https://brandnewtube.com/watch/the-straight-unswiveled-truth-on-snake-venom-claims-with-andrew-kaufman-m-d_OiS7maodBsbL2js.html
Dr Ardis says this simple theory of SNAKE Venom Poisoning is a threat to these other doctors who believe in the Mythology of Virology.
There is ZERO benefit from Vaccines ... they do NOTHING but HARM a person's health! 90% of your immune system RESPONSE is supported by the bacteria in a healthy GUT so it makes no sense to BYPASS this process and INJECT some TOXIN into your BLOODSTREAM.
The Criminal DEATH Camp (CDC) could be putting this in the water ... But the CDC says they are WATCHING the WASTE WATER for evidence of COVID, not the SUPPLY WATER.
Snake venom depletes your body of ZINC and COPPER which is a symptom of COVID causing a cytokine storm. That is why ZINC, HCQ, and Ivermectin work to STOP COVID because they inhibit the effects of Snake Venom! And Monoclonal Antibodies are Anti-Snake Venom treatments.
It is MORE than coincidental that treatments that inhibit SNAKE Venom poisoning ALSO work to inhibit the symptoms of COVID!
It is true the Snake Venom is normally destroyed in the GUT so it doesn't make it into the BLOODSTREAM but Drug companies have figured out 30 years ago how to get Snake Venom peptides past your GI tract into your bloodstream ... Merks's blood pressure "Lisinopril" is this very THING! --> https://en.wikipedia.org/wiki/Lisinopril
https://childrenshealthdefense.org/defender/scientist-james-lyons-weiler-on-snake-venom-theory/
Nass said the snake venom stuff is “hooey.” My analysis says yes, let’s move on to more productive pathways. I share two possible explanations for their presence in COVID-19 patients, one of which I favor over the other. Snakes were first floated as a potential intermediate host organism by a very early speculative report covered by SciAm in Jan 2020 that found codon usage bias most similar to snakes of all things. Codon usage bias is determined by the percentage of times specific codons (triplet nucleotides) are used to bring specific amino acids in place in protein sequences. It’s suggestive, but very, very weak and has not been taken seriously by anyone as sufficient evidence indicating snakes were the intermediate hosts. Reading the 2021 venom paper cited by Bryan Ardis, here is my breakdown: In Italy, with 20 COVID-19 samples and 10 control (non-COVID-19 patients), 5 plasma samples from COVID-19 patients and 3 fecal samples had evidence of proteins of unknown origin detected using a protein assay that led to the finding of animal venom proteins in their blood or feces. They sequenced the proteins and found multiple types of venoms, including snake venom proteins. That’s it. It’s a small study. Here’s one amino sequence from their study that seems to share similarities across many of the venom types from different animal species:
MKLVLAIVLILMLVSLSTGAEESGQEISMVGPPLYIWDPIPPCKQLDEDCGYGYSCCEDLSCQPLIEPDTMEITALVCQIESA (Learn how to analyze DNA and RNA sequences this summer in our Bioinformatics class at IPAK-EDU taught by yours truly.)
https://stevekirsch.substack.com/p/what-i-think-of-the-bryan-ardis-video?s=r
On April 14, 2022, a group of my colleagues met with Dr. Ardis and Dr. Tau Braun to discuss their discoveries. It was interesting in that opinions of the group varied widely from “this is totally worthless” to “I think we have to take this seriously.” I asked, “what’s the big message you are trying to convey?” Answer #1: “We are dealing with a venom problem.” The point is that if you realize that, you can apply solutions from a familiar domain. I then asked, “What’s the most important behavioral change you’d want people to make?” Answer #2: “Halt the vaccine immediately.” I needed to leave the call early to hop on the VSRF call. Bottom line: Collectively we don’t buy the story. We do agree the vaccines are dangerous and should be stopped. There is a nice writeup on this at About Those Venom Proteins… and that article links to Meryl Nass’s writeup. Looks like this is a hot topic considering the number of comments :). In this article, I give my overall reaction and then specifically respond to some of the key points in the video. We do agree there is evidence that the virus sequences are similar to snake venom but it’s not long enough to make a call on this. But as for the other assertions (such as it’s a poison spread through the water), nobody thinks that is the case. I’m going to have some water checked, just in case.
================= The New Age Trump Hopium Tour ==================
ReAwaken America Tour - May 14/15 in Myrtle Beach just 7 tickets left! ---> https://www.thrivetimeshow.com/reawaken-america-tour/
The Hopium Hype Tour ---> https://rumble.com/v11git5-kash-patel-and-the-nbas-jonathan-isaac-join-general-flynns-reawaken-america.html
I left this comment on Hugo Talk ---> https://hugotalks.com/2022/04/19/trumps-new-age-doctor-network-hugo-talks/
Hey Hugo thanks for this video ... MORE people need to CALL out this Hypocrisy, Strong Delusion and Cognitive Dissonance of Anti-JABBERS doctors who are campaigning for PRO-JAB Trump. I think these GOOD doctors who are warning of the DANGER and DECEPTION of the JAB are being led into GREATER Danger and Deception by PARTICIPATING in this New Age Great Awakening Tour for the WARP SPEED JAB-o-CIDE King "Trumple-Stills-Can", The MAGA Trump Hopium MOJO which began as a a FAKE Christian Revival movement back in 2016 has now MORPHED into a FULL Pagan New Age Humanism movement that is using Energy Frequencies, Positive Thinking and the Conjuring of Demonic Occult Spirits from the Pit of HELL to welcome in "The Antichrist and the Fallen Angles" (The name kind of sounds like a Head Banging Rock Group). I don't support the Left or the Right ... at this point ALL this Political Puppets are serving a MASTER that is Anti-Human (Satan) since they won't call out the Big Haram Terrorist, they won't STOP the Emergency Order, they won't EXPOSE the DEADLY JAB and they won't call out the REAL Globalist (The Illuminati, Freemasons, Jesuits, CIA, WEF, Club of Rome and the Zionist Bankers Federal Reserve) who actually RUN America and FUND this MAD March to the NWO/Great Reset/Antichrist/Beast Kingdom. BTW, Jesus is the ONLY One who can SAVE us ... NOT Trump or SCIENCE or Aliens from Outer Space! Jesus Only Y'all - JOY!
This how you DO Science ... you QUESTION the SCIENCE. I hope these good Doctors will CONTINUE to discuss the cause of this SCAM-DEMIC (which may have been nothing more than relableling the Cold and Flu as COVID) and STOP the JAB!!!
Steve Kirsch comment - The video "WATCH the WATER" is out. I've seen it. A few parts I agree with. For most other parts I'm skeptical. Bryan met with us so we had an opportunity to ask questions. Some think it is worthless. Some don't.
Dr. Bryan Ardis, COVID origins, Watch The Water, Snake Venom, Hour 2 ENCORE - Paul Barattiero, Hydration, Synergy Science, Anti-oxidant water, ECHO water options and MORE! ---> http://www.robertscottbell.com/natural-remedies/dr-bryan-ardis-covid-origins-watch-the-water-snake-venom-hour-2-encore-paul-barattiero-hydration-synergy-science-anti-oxidant-water-echo-water-options-and-more/
Dr Adris is EXCITED to be on the Hopium Tour ... These guys are networking together in support of the truth about the DANGER of the JAB but they really AREN'T trying to take down the DEEP State Cabal or EXPOSE the EVIL of Zionist Federal Reserve ... They just want the WARP SPEED King Trump to RULE over the NWO.
Rober Bell says we can address the "Energetic Power" of the body so you can heal yourself (This sounds like New Age Crap-o-la). The body is under the power of God ... He orchestrates LIFE and brings HEALING and Jesus is the POWER who holds ALL things together.
He is before all things, and in Him all things hold together. - Cor 1:17
The SPIKE in the Pathogen and the SPIKE Genetic mRNA code in the JAB is a synthetic form of SNAKE Venom from the King Snake or Crete Snake.
Drew Weissman and Katalin Kariko Developed the current mRNA JAB with NIH funding since 2009 ---> https://www.bu.edu/articles/2021/how-drew-weissman-and-katalin-kariko-developed-mrna-technology-inside-covid-vaccines/
By altering one of mRNA’s four building blocks, known as nucleosides, Weissman and Karikó found that their modified mRNA could fly under the radar of the body’s immune system, no longer causing inflammation. It was a game changer, and they both knew it.
They used SNAKE Venom to do the mRNA Gene editing ... to make the... to tie together Genetic code.
Dr Ardis is aware that MANY of his colleagues are NOT in agreement with his claims that COVID is Snake Venom but some Genetically modified Respiratory Coronavirus but they are ON the same page to RID the world of VACCINES!!!
The Straight Unswiveled Truth on Snake Venom Claims with Andrew Kaufman, M.D. ---> https://brandnewtube.com/watch/the-straight-unswiveled-truth-on-snake-venom-claims-with-andrew-kaufman-m-d_OiS7maodBsbL2js.html
Dr Ardis says this simple theory of SNAKE Venom Poisoning is a threat to these other doctors who believe in the Mythology of Virology.
There is ZERO benefit from Vaccines ... they do NOTHING but HARM a person's health! 90% of your immune system RESPONSE is supported by the bacteria in a healthy GUT so it makes no sense to BYPASS this process and INJECT some TOXIN into your BLOODSTREAM.
The Criminal DEATH Camp (CDC) could be putting this in the water ... But the CDC says they are WATCHING the WASTE WATER for evidence of COVID, not the SUPPLY WATER.
Snake venom depletes your body of ZINC and COPPER which is a symptom of COVID causing a cytokine storm. That is why ZINC, HCQ, and Ivermectin work to STOP COVID because they inhibit the effects of Snake Venom! And Monoclonal Antibodies are Anti-Snake Venom treatments.
It is MORE than coincidental that treatments that inhibit SNAKE Venom poisoning ALSO work to inhibit the symptoms of COVID!
It is true the Snake Venom is normally destroyed in the GUT so it doesn't make it into the BLOODSTREAM but Drug companies have figured out 30 years ago how to get Snake Venom peptides past your GI tract into your bloodstream ... Merks's blood pressure "Lisinopril" is this very THING! --> https://en.wikipedia.org/wiki/Lisinopril
https://childrenshealthdefense.org/defender/scientist-james-lyons-weiler-on-snake-venom-theory/
Nass said the snake venom stuff is “hooey.” My analysis says yes, let’s move on to more productive pathways. I share two possible explanations for their presence in COVID-19 patients, one of which I favor over the other. Snakes were first floated as a potential intermediate host organism by a very early speculative report covered by SciAm in Jan 2020 that found codon usage bias most similar to snakes of all things. Codon usage bias is determined by the percentage of times specific codons (triplet nucleotides) are used to bring specific amino acids in place in protein sequences. It’s suggestive, but very, very weak and has not been taken seriously by anyone as sufficient evidence indicating snakes were the intermediate hosts. Reading the 2021 venom paper cited by Bryan Ardis, here is my breakdown: In Italy, with 20 COVID-19 samples and 10 control (non-COVID-19 patients), 5 plasma samples from COVID-19 patients and 3 fecal samples had evidence of proteins of unknown origin detected using a protein assay that led to the finding of animal venom proteins in their blood or feces. They sequenced the proteins and found multiple types of venoms, including snake venom proteins. That’s it. It’s a small study. Here’s one amino sequence from their study that seems to share similarities across many of the venom types from different animal species:
MKLVLAIVLILMLVSLSTGAEESGQEISMVGPPLYIWDPIPPCKQLDEDCGYGYSCCEDLSCQPLIEPDTMEITALVCQIESA (Learn how to analyze DNA and RNA sequences this summer in our Bioinformatics class at IPAK-EDU taught by yours truly.)
https://stevekirsch.substack.com/p/what-i-think-of-the-bryan-ardis-video?s=r
On April 14, 2022, a group of my colleagues met with Dr. Ardis and Dr. Tau Braun to discuss their discoveries. It was interesting in that opinions of the group varied widely from “this is totally worthless” to “I think we have to take this seriously.” I asked, “what’s the big message you are trying to convey?” Answer #1: “We are dealing with a venom problem.” The point is that if you realize that, you can apply solutions from a familiar domain. I then asked, “What’s the most important behavioral change you’d want people to make?” Answer #2: “Halt the vaccine immediately.” I needed to leave the call early to hop on the VSRF call. Bottom line: Collectively we don’t buy the story. We do agree the vaccines are dangerous and should be stopped. There is a nice writeup on this at About Those Venom Proteins… and that article links to Meryl Nass’s writeup. Looks like this is a hot topic considering the number of comments :). In this article, I give my overall reaction and then specifically respond to some of the key points in the video. We do agree there is evidence that the virus sequences are similar to snake venom but it’s not long enough to make a call on this. But as for the other assertions (such as it’s a poison spread through the water), nobody thinks that is the case. I’m going to have some water checked, just in case.
================= The New Age Trump Hopium Tour ==================
ReAwaken America Tour - May 14/15 in Myrtle Beach just 7 tickets left! ---> https://www.thrivetimeshow.com/reawaken-america-tour/
The Hopium Hype Tour ---> https://rumble.com/v11git5-kash-patel-and-the-nbas-jonathan-isaac-join-general-flynns-reawaken-america.html
I left this comment on Hugo Talk ---> https://hugotalks.com/2022/04/19/trumps-new-age-doctor-network-hugo-talks/
Hey Hugo thanks for this video ... MORE people need to CALL out this Hypocrisy, Strong Delusion and Cognitive Dissonance of Anti-JABBERS doctors who are campaigning for PRO-JAB Trump. I think these GOOD doctors who are warning of the DANGER and DECEPTION of the JAB are being led into GREATER Danger and Deception by PARTICIPATING in this New Age Great Awakening Tour for the WARP SPEED JAB-o-CIDE King "Trumple-Stills-Can", The MAGA Trump Hopium MOJO which began as a a FAKE Christian Revival movement back in 2016 has now MORPHED into a FULL Pagan New Age Humanism movement that is using Energy Frequencies, Positive Thinking and the Conjuring of Demonic Occult Spirits from the Pit of HELL to welcome in "The Antichrist and the Fallen Angles" (The name kind of sounds like a Head Banging Rock Group). I don't support the Left or the Right ... at this point ALL this Political Puppets are serving a MASTER that is Anti-Human (Satan) since they won't call out the Big Haram Terrorist, they won't STOP the Emergency Order, they won't EXPOSE the DEADLY JAB and they won't call out the REAL Globalist (The Illuminati, Freemasons, Jesuits, CIA, WEF, Club of Rome and the Zionist Bankers Federal Reserve) who actually RUN America and FUND this MAD March to the NWO/Great Reset/Antichrist/Beast Kingdom. BTW, Jesus is the ONLY One who can SAVE us ... NOT Trump or SCIENCE or Aliens from Outer Space! Jesus Only Y'all - JOY!